SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007969 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007969
Domain Number 1 Region: 680-871
Classification Level Classification E-value
Superfamily HAD-like 1.5e-34
Family Meta-cation ATPase, catalytic domain P 0.05
Further Details:      
 
Domain Number 2 Region: 126-217,364-437,872-1089
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-33
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 
Domain Number 3 Region: 224-284,323-358
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.55e-18
Family Calcium ATPase, transduction domain A 0.0068
Further Details:      
 
Domain Number 4 Region: 423-455,490-693
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000000000000414
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007969   Gene: ENSGGOG00000008135   Transcript: ENSGGOT00000008187
Sequence length 1098
Comment pep:known_by_projection chromosome:gorGor3.1:18:77569382:77883652:1 gene:ENSGGOG00000008135 transcript:ENSGGOT00000008187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEE
GFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWL
GCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRGKVQVKSSDIQVGDLIIV
EKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSISAYV
YAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSV
MNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRSLFRFLLLFSYII
PITLTQNEMIFKRLHLGTVSYGADMMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSS
APKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTGETEFAEADQDFSDENRTYQASSP
DEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDEST
AEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQ
AKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDK
LETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKY
YEHEFVELACQCPAVVCCRCSPTQKACIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGI
GIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVF
SSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLS
FKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVALTVRTWHWLM
VVAEFLSLGCYVSSLAFLSEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYV
LKYLRRKLSPPSYCKLAS
Download sequence
Identical sequences ENSGGOP00000007969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]