SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007980 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007980
Domain Number 1 Region: 620-862
Classification Level Classification E-value
Superfamily VPS9 domain 4.84e-50
Family VPS9 domain 0.00079
Further Details:      
 
Domain Number 2 Region: 62-184
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000872
Family SH2 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007980   Gene: ENSGGOG00000008161   Transcript: ENSGGOT00000008199
Sequence length 983
Comment pep:known_by_projection chromosome:gorGor3.1:14:74291673:74475466:1 gene:ENSGGOG00000008161 transcript:ENSGGOT00000008199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRHAGAPARGDPTGPVPAVGKGEEEEEEDGMRLCLPANPKNCLPRRRGISILEKLIKTC
PVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKHLVLCVHFPSLNESSAEVLEYTVKEE
KSILYLEGSALVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFW
DSSLNPPQERGKPAEPPRDRAPGFPVVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFI
EDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPLL
PALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMTTCERLPCPTAGLGPLREEAMK
PGAASSPLQQAPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD
GPEDTPWESTEQGQDTEVKASDPDSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLEN
AELCTQALALETPTPGPPREGQSPASQAGNQHPPAQATAHSQSSPEFKGSLASLSDSLGV
SVMATDQDSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRK
LYKKVVELAQDKASYFGSLVQDYKVYSLEMMARQTSSTELLQEIRTMMTQLKSYLLQSTE
LKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHEIHSKDGSLQQLKENQLVIL
ATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIYDSMALGNPGK
PYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADT
QAQALCAQCAEKFAVERPQAHRLFVLVDGRCFQLADDALPHRIKGYLLRSEPKRDFHFVY
RPLDGGGGDGSLPCLVVREPNFL
Download sequence
Identical sequences ENSGGOP00000007980 ENSGGOP00000007980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]