SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007982 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007982
Domain Number 1 Region: 140-261
Classification Level Classification E-value
Superfamily R3H domain 4.19e-41
Family R3H domain 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007982   Gene: ENSGGOG00000008156   Transcript: ENSGGOT00000008201
Sequence length 1100
Comment pep:known_by_projection chromosome:gorGor3.1:2b:22630375:22826311:1 gene:ENSGGOG00000008156 transcript:ENSGGOT00000008201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSDTVTVKDETATMKDLEAEVKDTTRVENLIKSENYGKILVEKNEHCIENNIDLQRPL
QSFGQTGKRSKSSSKLKLVRSLAVCEESPPPPAPEISQENQEKIQIQLTQSFEKEEKPSK
DEAEKEKASDKLPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKNNPRDRMMLLKLEQEILD
FIGNNESPRKKFPPMTSYHRMLLHRVAAYFGLDHNVDQSGKSVIVNKTSNTRIPDQKFNE
HIKDDKGEDFQKRYILKRDNSSFDKDDNQMRIRLKDDRRSKSIEEREEEYQRARDRIFSQ
DSLCSQENYIIDKRLQDEDASSTQQRRQIFRVNKDASGRSTNSHQSSTENELKYSEPRPW
SSTDSDSSLRNLKPAVTKASSFSGISVLTRGDSSGSSKSIGRLSKTGSESSGSVGSSTGS
LSHIQQPLPGTALSQSSHGAPVVYPTVSTHSSLSFDGGLNGQVASPSTSFFLLPLEAAGI
PPGSILINPQTGQPFINPDGSPVVYNPPMTQQPVRSQVPGPPQPPLPAPPQQPAANHIFS
QQDNLGSQFSHMSLARQPSADGSDPHAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPP
PPPPPPLPPGQPVPTAGYPASGHPVSQPVLQQQGYIQQPSPQMPACYCTPGHYHSSQPQY
RPVPSVHYNSHLNQPLPQPAQQTGYQVIPNQQQNYQGIVGVQQPQNQSLVSGQPNSIGNQ
IQGVVIPYTSVPTYQVSLPQGSQGIPHQTYQQPVMFPNQSNQGSVPTTGMPVYYSVIPPG
QQNNLSSSVGYLQHPGSEQVQFPRTTSPCSSQQLQGHQCTAGPPPPPGGGMVMMQLSLPN
NPQSCAHSPPQWKQNKYYCDHQRGQKCVEFSSVDSIVQHSPQLSSPIISPAQSPAPAQLS
TLKTVRPSGPPLSIMPQFSRPFVPGQGDSRYPLLGQPLQYNPPAVLHGHIPNQQGQPGSR
HGNRGRRQAKKAASTDLGAGETVVGKVLEITELPDGITRMEAEKLFGELFKIGAKIRWLR
DPQSQPRRHPLCCGSGDNTVNPERSKPSDLASTYTVLATFPSISAAQNALKKQINSVNKF
KLRTSKKHYDFHILERASSQ
Download sequence
Identical sequences G3QYP1
XP_004032641.1.27298 ENSGGOP00000007982 ENSGGOP00000007982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]