SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008010 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008010
Domain Number 1 Region: 471-661,757-1076
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.77e-71
Family Tandem AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 93-147
Classification Level Classification E-value
Superfamily UBA-like 0.00000135
Family UBA domain 0.038
Further Details:      
 
Domain Number 3 Region: 226-250
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000288
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008010
Domain Number - Region: 267-345
Classification Level Classification E-value
Superfamily UBC-like 0.00641
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008010   Gene: ENSGGOG00000008187   Transcript: ENSGGOT00000008230
Sequence length 1277
Comment pep:known_by_projection chromosome:gorGor3.1:2a:39460834:39523387:-1 gene:ENSGGOG00000008187 transcript:ENSGGOT00000008230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPSNSNISKGESRPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQEQDADAGSERGISGE
EEDDEPDCCNDERYWPAGQEPSLVPDLDPLEYAGLASVEPYVPEFTVSPFAVQKLSRYGF
NIERCQAVLRMCDGDVGASLEHLLTQCFSETFGERMKISEAVNQISLDECMEQRQEEAFA
LKSICGEKFIERIQNRVWTIGLELEYLTSRFRKSKPKESTKNVQENSLEICKFYLKGNCK
FGSKCKFKHEVPPNQIVGRVERSVDDSHLNANEDASFLYELEIRFSKDHKYPYQAPLVAF
YSTNENLPLACRLHISEFLYDKALTFAETSEPVVYSLITLLEEESEIVKLLTNTHHKYSV
PPVNFLPVPSRTRINNPACHKPVIPNNSFVSNQIPEVEKASESEESDEDDGPAPVIVENE
SYVNLKKKISKRYDWQAKSVHVENGKICKQFRMKQASRQFQSILQERQSLPAWEERETIL
NLLRKHQVVVISGMTGCGKTTQIPQFILDDSLNGPPEKVANIICTQPRRISAISVAERVA
KERAERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDTALQGVSHIIVDEVHERT
EESDFLLLVLKDIVSQRPGLQVILMSATLNAELFSDYFNSCPVITIPGRTFPVDQFFLED
AIAVTRYVLQDGSPYMRSMKQISKEKLKARRNRTAFEEVEEDLRLSLHLQDQDSVKDAVP
DQQLDFKQLLARYKGVSKSVIKTMSIMDFEKVNLELIEALLEWIVDGKHSYPPDPGAILV
FLPGLAEIKMLYEQLQSNSLFNNRRSNRCVIHPLHSSLSSEEQQAVFVKPPAGVTKIIIS
TNIAETSITIDDVVYVIDSGKMKEKRYDASKGMESLEDTFVSQANALQRKGRAGRVASGV
CFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSAHNLQSVFSRLIEPPHTDS
LRASKIRLRDLGALTPDEKLTPLGYHLASLPVDVRIGKLMLFGSIFRCLDPALTIAASLA
FKSPFVSPWDKKEEANQKKLEFAFANSDYLALLRAYKGWQLSTKEGVRASYNYCRQNFLS
GRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKL
ISAMLCAALYPNVVQVKSPEGKFQKTSTGAVRMQPKSAELKFVTKNDGYVHIHPSSVNYQ
VRHFDSPYLLYHEKIKTSRVFIRDCSMVSVYPLVLFGGGQVNVQLQRGEFVVSLDDGWIR
FVAASHQVKAELVCFMR
Download sequence
Identical sequences ENSGGOP00000008010 ENSGGOP00000008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]