SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008037 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008037
Domain Number 1 Region: 296-553
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.31e-99
Family STAT DNA-binding domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 106-301
Classification Level Classification E-value
Superfamily STAT 1.77e-54
Family STAT 0.00019
Further Details:      
 
Domain Number 3 Region: 554-671
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-33
Family SH2 domain 0.00025
Further Details:      
 
Domain Number 4 Region: 1-107
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 9.68e-31
Family Transcription factor STAT-4 N-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008037   Gene: ENSGGOG00000008216   Transcript: ENSGGOT00000008258
Sequence length 769
Comment pep:known_by_projection chromosome:gorGor3.1:5:41768212:41854801:1 gene:ENSGGOG00000008216 transcript:ENSGGOT00000008258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQGSSPAGSLADAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVS
LEWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGS
LDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTST
FIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRND
YSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVG
GNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEAL
NMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGRNYTFW
QWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAW
KFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPSKAV
DGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGD
FDLEDTMDVARRVEELLGRPMDSRGSRTHSRDPATSPSFFILTRGSVLW
Download sequence
Identical sequences ENSGGOP00000008037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]