SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008069 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008069
Domain Number 1 Region: 171-250
Classification Level Classification E-value
Superfamily HMG-box 2.36e-21
Family HMG-box 0.00000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008069   Gene: ENSGGOG00000008257   Transcript: ENSGGOT00000008294
Sequence length 287
Comment pep:known_by_projection chromosome:gorGor3.1:5:117540316:117573225:1 gene:ENSGGOG00000008257 transcript:ENSGGOT00000008294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPTSGAGQHPQPQPPLHKANQPPHGVP
QLSLYEHFNSPHPTPAPADISQKQAVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPS
LMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM
LYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWS
ARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
Download sequence
Identical sequences ENSGGOP00000008069 ENSGGOP00000008069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]