SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008108 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008108
Domain Number 1 Region: 62-179
Classification Level Classification E-value
Superfamily L domain-like 3.84e-26
Family Ngr ectodomain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008108   Gene: ENSGGOG00000008300   Transcript: ENSGGOT00000008334
Sequence length 275
Comment pep:known_by_projection chromosome:gorGor3.1:5:44208737:44211949:-1 gene:ENSGGOG00000008300 transcript:ENSGGOT00000008334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLSLLLVIGTGGTVPSPQVPPQGCYVAKEAGE
RTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPALEELDLSHNALAHLSG
AAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPG
TGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLVVAYL
VHYVWQNRDETRRSLKRAPVLPMRSEDSSILSTVV
Download sequence
Identical sequences G3QZ10
XP_004041792.1.27298 ENSGGOP00000008108 ENSGGOP00000008108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]