SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008146 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008146
Domain Number 1 Region: 374-504
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-34
Family C-type lectin domain 0.00088
Further Details:      
 
Domain Number 2 Region: 174-359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 1242-1381
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-30
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 4 Region: 807-939
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 5 Region: 1117-1237
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 6 Region: 954-1100
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-27
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 7 Region: 659-800
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-25
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 8 Region: 37-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.79e-24
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 9 Region: 510-646
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-23
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008146   Gene: ENSGGOG00000008322   Transcript: ENSGGOT00000008372
Sequence length 1463
Comment pep:known_by_projection chromosome:gorGor3.1:2b:47532718:47651502:-1 gene:ENSGGOG00000008322 transcript:ENSGGOT00000008372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRK
MITGPLQYSVQVAHDNTVVASRKYFHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGALLSITDETEENFIREHMSSKTVEVWMGLSQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
AEQSEGHWKVKNCEETLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEP
VQYTHWNAHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
LLHSKFNWTEERQFWIGFSKRNPLNAGSWEWSDRTPVVSSFLDNNYFGEDARNCAVYKAN
KTLLPLHCASKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAREQEFIHNKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPK
GWLYFNYKCLLLNIPKDPSSWKNWPHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTS
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
TCLMHGAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADTNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSLSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKRGFICKME
AEVFLFLKKNLSGPSHSIIPLAVVLTLIVIVAICTLSFFIYKHNGAFFRRLAGFRNPYYP
ATNFSTVHLEENILISDLEKSDQ
Download sequence
Identical sequences ENSGGOP00000008146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]