SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008160 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008160
Domain Number 1 Region: 186-328
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-40
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 86-188
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-27
Family Second domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 10-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-19
Family First domain of FERM 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008160
Domain Number - Region: 460-485
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0759
Family Probable GTPase Der, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008160   Gene: ENSGGOG00000008350   Transcript: ENSGGOT00000008387
Sequence length 689
Comment pep:known_by_projection chromosome:gorGor3.1:X:129585029:129609032:-1 gene:ENSGGOG00000008350 transcript:ENSGGOT00000008387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSSKKFFTESSSKLLFSGQQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLEL
LKPITKQVKNPKEIVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTA
LMVSHILQSELGDFHEETDRKHLAQTRYLPNQDCLEGKIMHFHQKHIGRSPAESDILLLD
IARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFL
IKLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSF
RYSGRTQRQLLEYGRKGRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYG
GGYYQNVNGVHKPEADPTLLHQSQSSSSFPFIYMDPVFNTEPDPNPDPRDIFSERSSLSS
FQTSCKFSGNHMSISSGLTSKVRPAKQLTYTDVPYIPCTGQQVGIMPPQVFFYVDKPPQV
PRWSPIRAEERTSPDSYVEPTAMKPAKRSPRNIRMKSFQQDLQGLQEAIARTSGRSNINV
GLEEEDPNLEDAFVYNIQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPCPALSHKADLFTD
MFAEQELPAVLMDQSTAERYVASESSDSESEILKPDYYALYGKEIRSPMARIRLSSGSLQ
LDEEDEDAYFNTPTAEDRTSLKPCNYFLA
Download sequence
Identical sequences ENSGGOP00000008160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]