SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008165 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008165
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000964
Family Calponin-homology domain, CH-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 146-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000663
Family LIM domain 0.0086
Further Details:      
 
Domain Number 3 Region: 115-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000165
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008165   Gene: ENSGGOG00000008348   Transcript: ENSGGOT00000008392
Sequence length 808
Comment pep:known_by_projection chromosome:gorGor3.1:22:22250547:22279935:1 gene:ENSGGOG00000008348 transcript:ENSGGOT00000008392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGLEDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYY
NHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTC
AACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPG
TRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKP
RVPGKLQELASPAAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRL
HELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPGSSPGPPNQDGRQVEN
GGTEEVAQPSPAASLESKPYNPSPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTK
KRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPK
SSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAK
PCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSK
PVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNE
GREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPAKDIHE
HETLGAALFLQQSICVVSNRAVGTSLGESSLLKINVDAMLQNSWILDSEFQREAEPEGKK
KGKFKTMKMLKLLGNKRDAKSKSPRDKS
Download sequence
Identical sequences ENSGGOP00000008165 ENSGGOP00000008165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]