SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008179 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008179
Domain Number 1 Region: 306-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-48
Family SPRY domain 0.0002
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 7.66e-21
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000321
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008179   Gene: ENSGGOG00000008371   Transcript: ENSGGOT00000008406
Sequence length 507
Comment pep:known_by_projection chromosome:gorGor3.1:6:31167632:31194108:-1 gene:ENSGGOG00000008371 transcript:ENSGGOT00000008406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRICTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWAGYGDGYDDWETDEDEESLGEVLESCMVGVARDSMKRKGDL
SLRPEDGVWALRLSSSGIWANTSPEAELFPALRPRRVGIALDYEGGTVTFTNAESQELIY
TFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences ENSGGOP00000008179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]