SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008181 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008181
Domain Number 1 Region: 852-881
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000133
Family A20-like zinc finger 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008181   Gene: ENSGGOG00000008369   Transcript: ENSGGOT00000008408
Sequence length 886
Comment pep:known_by_projection chromosome:gorGor3.1:15:9851292:9938474:-1 gene:ENSGGOG00000008369 transcript:ENSGGOT00000008408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGYKVERPCLQRQDD
IAQEKRLSRGISHASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFI
ERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDL
VLRKALYTMMRTGAEREALKRRWRWQQTQQNKESGLVYTEEEWEREWTELLKLASSEPRT
HFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPF
GGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHF
AVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPT
ASAGEDVQSLADSLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSF
SKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASAS
TSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGL
LLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPET
EGAPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRAGASGPVPG
RSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTV
NTVESLARAAPGALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGR
GGPGPVQRRCQRENCAFYGRAETEHYCSYCYREELRRRREARGARP
Download sequence
Identical sequences ENSGGOP00000008181 ENSGGOP00000008181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]