SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008183 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008183
Domain Number 1 Region: 165-364
Classification Level Classification E-value
Superfamily vWA-like 2.23e-55
Family Integrin A (or I) domain 0.00037
Further Details:      
 
Domain Number 2 Region: 850-1055
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.41e-28
Family Laminin G-like module 0.06
Further Details:      
 
Domain Number 3 Region: 657-830
Classification Level Classification E-value
Superfamily Fibronectin type III 4.37e-21
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 4 Region: 387-546
Classification Level Classification E-value
Superfamily Fibronectin type III 5.8e-19
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 564-652
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000168
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 32-103
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000011
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008183   Gene: ENSGGOG00000008361   Transcript: ENSGGOT00000008410
Sequence length 1331
Comment pep:known_by_projection chromosome:gorGor3.1:20:61534993:61574276:1 gene:ENSGGOG00000008361 transcript:ENSGGOT00000008410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGAPAHLGLCLWLWLGATLGREQVQASGLLRLSVLPEDRLQMKWRESEGSGLGYLVQV
KPMAGDSEQEVILTTKTPKATVGGLSPSKGYTLQIFELTGSGRFLLARREFVIEDLKSSS
LDRSSQRPLSSGAPEPTPSHTGSPDLEQASEPQVAFTPSQDPPTRGGSEWRETGPQFRCL
PPVPADMVFLVDGSWSIGHSHFQQVKDFLASVIAPFEIGPDKVQVGLTQYSGDAQTEWDL
NSLSTKEQVLAAVRRLRYKGGNTFTGLALTHVLGQNLQPAAGLRPEAAKVVILVTDGKSQ
DDVHTAAHVLKDLGVNVFAVGVKNADEAELRLLASPPRDITVHSVLDFLQLGALSGLLSR
LICQRLQGGSPRQGPAAAAPALDTLPAPTSLVLSQVTSSSIRLSWTPAPRHPLKYLIVWR
ASRGGTPREVVVEGPAASTELHNLASRTEYLVSVFPIYEGGVGEGLRGLVTTAPLPPPRA
LTLAAVTPRTVHLTWQPSAGATHYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDY
EVSVQSLRGPEGSEARGIRARTPALAPPRHLGFSDVSHDEARVFWEGAPRPVRLVRVTYV
SSEGGHSGQTEAPGNATSATLGPLSSSTTYTVRVTCLYPGGGSSTLTGQVTTKKAPSPSQ
LSVTELPGDAVQLAWVAAAPSGVLVYQITWTPLGEGKAHEISVPGNLGTAVLPGLGRHTE
YDVTILAYYRDGARSDPVSLRYTPSTVSRSPPSNLALASETPDSLQVSWTPPLGRVLHYW
LTYAPASGLGPEKSVSVPGPRSHVTLPDLQAATKYRVLVSAIYAAGRSEAVSATGQTAAC
PALGPDGSLPGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVH
PAPLPPEHTIVFLVRLLPETPREAFALWQMTAEDFQPLLGVLLDAGKKSLTYFHRDPRAA
LQEATFDPQEVRKIFFGSFHKVHVAVGRSKVRLYVDCRKVAERPLGEMGSPPAAGFVTLG
RLAKARGPRSSSAAFQLQMLQIVCSDTWADEDRCCELPASRDGETCPAFVSACSCSSETP
GPPGPQGPPGLPGRNGTPGEQGFPGPRGEPGPPGQMGPEGPGGQQGSPGTQGRAVQGPVG
PPGVKGEKGDHGLPGLQGHPGHQGIPGRVGLQGPKGMRGLEGTAGLPGPPGPRGFQGMAG
ARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQLVSQACESAIQTHVSKFDSF
HENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGRGEPGAVGQTGSPG
KQGASIQGLWE
Download sequence
Identical sequences ENSGGOP00000008183 ENSGGOP00000008183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]