SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008203 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008203
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-31
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008203   Gene: ENSGGOG00000008396   Transcript: ENSGGOT00000008430
Sequence length 131
Comment pep:known_by_projection chromosome:gorGor3.1:19:46446395:46448496:1 gene:ENSGGOG00000008396 transcript:ENSGGOT00000008430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKR
GDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQ
HQSYSSLESRG
Download sequence
Identical sequences ENSGGOP00000008203 ENSGGOP00000008203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]