SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008237 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008237
Domain Number 1 Region: 42-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008237   Gene: ENSGGOG00000008431   Transcript: ENSGGOT00000008465
Sequence length 119
Comment pep:known_by_projection chromosome:gorGor3.1:1:24361296:24363212:-1 gene:ENSGGOG00000008431 transcript:ENSGGOT00000008465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Download sequence
Identical sequences A0A024RAC4 A0A1U7TQF2 A0A2K5DR74 A0A2K5SGF6 A0A2K6S2E6 F7IIH1 G1TSC9 G3QZD1 H2PYA7 M3YWR1 Q712G9
ENSCJAP00000038987 GO.38500 GO.78735 HR3111 ENSGGOP00000008237 ENSMPUP00000015771 ENSPTRP00000000580 ENSPTRP00000000580 ENSCJAP00000038987 ENSOCUP00000019943 ENSGGOP00000008237 NP_001003025.1.84170 XP_002716031.1.1745 XP_003307918.1.37143 XP_003934923.1.74449 XP_004024934.1.27298 XP_004394823.1.74151 XP_004741259.1.14098 XP_006737643.1.47382 XP_008060000.1.4292 XP_008998872.1.60252 XP_012295490.1.9421 XP_017390015.1.71028 XP_019317312.1.44245 XP_021539217.1.83697 9598.ENSPTRP00000000580 9615.ENSCAFP00000019544 9986.ENSOCUP00000019943 ENSOCUP00000019943 ENSMPUP00000015771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]