SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008253 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008253
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily EF-hand 0.00000184
Family S100 proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008253   Gene: ENSGGOG00000008451   Transcript: ENSGGOT00000008482
Sequence length 2076
Comment pep:novel chromosome:gorGor3.1:1:131316968:131326515:-1 gene:ENSGGOG00000008451 transcript:ENSGGOT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLLRSVVTVIDVFYKYTKQDGECGTLSKGELKELLEKEFHPILKENFPQNCGGQWRTG
SSQSSCGQYGSGGSQSCSNDQHEYGSCGRFSNSSSSNEFSKCDQYGSGSGQSTSFEQHGT
GLSQSSGFEQHVRGSGQTCGQHESTSSQSLGYDQHGSSSGKTSGFGQHGSGSGQSSGFGQ
CGPGSGQSPGFGQHASVSGQSSGFEQHGSVSGQSSGFGQHESRSRQSSYGQHGSGSSQSS
GYGQYGSRETSGFGQHGLGSGQSTGFGQYGSGSGQSSGFGQHGSSSGQSSGFGQHESRSG
QSSYGQHSSGSSQSSGYGQHGCRQTSGFGQHGSGSSQSTGFGQYGSGSGQYSGFGQHVSG
SGQSCGFGEHESRSGHSSYGQHGFGSSQSSGCGQRGSSSGQTSGFGQHELSSGQSSSFGQ
HGSGSGQSSGFGQHGSGSGQSSGFGQHESRSGQSSYGQHSSGSSQSSGYGQHGSRQTSGF
GQHGSGSSQSTGFGQYGSGSGQSAGFGQHGSGSGQSSGFGHHESKSHQSSYGQHGSGSSQ
SSGYGQHGSSSGQTSGFGQHRSSSGQYSGFGQHGSGSGQSSGFGQHGTGSGQYSGFGQHE
SRSHQSSYGQHGSGSSQSSGYGQHGSSSGQTFGFGQHRSGSGQSSGFGQHGSGSGQSSGF
GQHESGSGQSSGFGQHESRSSQSNYGQHGSGSSQSSGYGQHGSSSGQTTGFGQHRSSSGQ
YSGFGQHGSASGQSSGFGQHGTGSGQSSGFGQYESRSRQSSYGQHGSGSIQSSGYGQHGS
NSGQTSGFGQHRSGSGQSSGFGQYGSGLGQSSGFGQHGSGTGKSSGFAQHEYRSGQSSYG
QHGTGSSQSSGCGQHESGSGPTTGFGQHVSGSDNFSSSGQHISDSGQSTGFGQYGSGSGQ
STGLGQGESQQVESGSTVHGRQETTHGQTVNTTRHSQSGQGQSTQIGSRVTRRRRSSQSE
NSDSEVHSRVSHRHSEHIHTQAGSHYPKSGSTVRRRQGTTHGQRGDTTRHGHSGHGQSTQ
TGSRTSGRQRFSYSDATDNEVHSGVSHRPHSQEQTHSQAGSQHGESESTVHERHETTYGQ
TGEATGHGHSGHGQSTQTGSRTTGRQRTSHSESTDSEVHSGVSHRTHSREHTYGQARSQH
GEPEFTVHERHGTTHGQTGDTTRHAHYHHGVTTQTGSRTTGRRGSGHSEYSDSEGYSRVS
HTHSGHTHGQARSQHGESESIVHERHGTIHGQTGDTTRHAHSGHGQSTQTGSRTTGRRSS
GHSEYSDSEGHSGFSQRPHSRGHTHSQAGSQHGESESIVDERHRTTHGQTGDTSGHSQSG
HGQSTQSGSSTTGRRSGHSESSDSEVHSGGSHTHSGHPHSQARSQHGESESTVHKRHQTT
HGQTGDTTEHGHPSHGQTTQTGSRTTGRRGSGHSEYSDSEGHSGVSHTHSGHTHGQAGSH
YPESGSSVHERHRTTHGQTADTTRHGHSGHGQSTQRGSRTTGRRASGHSEYSDSEGHSGV
SHTHSGHAHGQAGSQHGEPEFTVHERHGTTHGQTGDTTRHAHSGHGQSTQRGSRTAGRRG
SGHSESSDSEVHSGVSHTHSGHTYGQARSQHGESGSAIHGRQGTIHGQTGDTTRHGQSGH
GQSTQTGSRTTGRQRSSHSESSDSEVHSEASPTNSGHPHSQAGSRHGQSGSSGHGRQGTT
HGQTGDTTRHAHYHHGVTTQTGSRTTGRRGSGHSEYSDSEGYSRVSHTHSGHTHGQARSQ
HGESESIVHERHGTIHGQTGDTTRHAHSGHGQSTQTGSRTTGRRSSGHSEYSDSEGHSGF
SQRPHSRGHTHSQAGSQHGESESAIHERHGTTHGQTGDTTRHAHSGHGQSTQRGSRTAGR
RGSGHSESSDSEVHSGVSHTHSGHTYGQARSQHGESGSAIHGRQGTIHGQTGDTTRHGQS
GHGQSTQTGSRTTGRQRSSHSESSDSEVHSETSPTNSGHPHSQAGSRHGQSGSSGHGRQG
TTHGQTGDTTRHGHSSYGQSTQTGSRSSRTSHFQSHSSERQRHGSSQVWKHGSYGPAEYD
YGHTGYGPSGGSRKSISNSHLSWSIDSTANKQLSRH
Download sequence
Identical sequences ENSGGOP00000008253 ENSGGOP00000008253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]