SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008258 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008258
Domain Number 1 Region: 95-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-88
Family Calnexin/calreticulin 0.00000000256
Further Details:      
 
Domain Number 2 Region: 304-444
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.79e-58
Family P-domain of calnexin/calreticulin 0.0000000342
Further Details:      
 
Domain Number 3 Region: 447-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000222
Family Calnexin/calreticulin 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008258   Gene: ENSGGOG00000008450   Transcript: ENSGGOT00000008487
Sequence length 627
Comment pep:known_by_projection chromosome:gorGor3.1:5:164258354:164292079:1 gene:ENSGGOG00000008450 transcript:ENSGGOT00000008487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRRTPTPSAGCRLPRQRRARDASQASAPGTGRIMEGKWLLCMLLVLGTAIVEAHDGHD
DDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWIL
SKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKP
LIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFR
HKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLND
MTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLD
DEPEYVPDPDAEKPEDWEEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKP
PMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRR
IVDDWASDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSG
KKQTSAMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQ
EEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences ENSGGOP00000008258 ENSGGOP00000008258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]