SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008273 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008273
Domain Number 1 Region: 346-651
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.84e-52
Family Rhodopsin-like 0.00054
Further Details:      
 
Domain Number 2 Region: 50-250
Classification Level Classification E-value
Superfamily L domain-like 2.27e-33
Family Ngr ectodomain-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008273   Gene: ENSGGOG00000008461   Transcript: ENSGGOT00000008502
Sequence length 701
Comment pep:known_by_projection chromosome:gorGor3.1:2a:49578288:49648182:-1 gene:ENSGGOG00000008461 transcript:ENSGGOT00000008502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQRFSALQLLKLLLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAY
LPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGA
FINLPRLKYLSICNTGIRKFPDVTKIFSSESNFILEICDNLHITTIPGNAFQGMNNESVT
LKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALP
SYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISE
NFSKQCESTVRKLNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMG
YDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASV
DSQTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKL
RLRHAILIMLGGWLFSSLVAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVA
FFIICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPL
ITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSA
YTSNCKNGFTGSNKPSRSTLKLSTLHCQGTALLDKTCYTEC
Download sequence
Identical sequences G3QZG4
XP_004029268.1.27298 ENSGGOP00000008273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]