SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008276 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008276
Domain Number 1 Region: 206-435
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.2e-55
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 44-164
Classification Level Classification E-value
Superfamily POZ domain 3.66e-28
Family Tetramerization domain of potassium channels 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008276   Gene: ENSGGOG00000008470   Transcript: ENSGGOT00000008505
Sequence length 503
Comment pep:known_by_projection chromosome:gorGor3.1:8:109331542:109339255:-1 gene:ENSGGOG00000008470 transcript:ENSGGOT00000008505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEMPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALS
CFPHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYR
TGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRRYFRRKELSETLDFKKDTEDQESQ
HESEQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWL
DLQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSG
SQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI
SIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI
LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIM
EMLRLKGRERASTRSSGGDDFWF
Download sequence
Identical sequences ENSGGOP00000008276 ENSGGOP00000008276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]