SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008279 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000008279
Domain Number - Region: 48-96
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0403
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008279   Gene: ENSGGOG00000008473   Transcript: ENSGGOT00000008508
Sequence length 162
Comment pep:novel chromosome:gorGor3.1:4:128233353:128250697:1 gene:ENSGGOG00000008473 transcript:ENSGGOT00000008508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHLQLKIREVPRRSCSHQSHGAAREAEAPPSGPPPNWHHCCPCPYSQPHVTGQRQWWGSQ
GSVKSLSQLQDKFEHLKMIQREEIRKFEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTK
KDKHPDPYEFLSLRKIKHPGFNEELTITLLIIQKHVAGLSYF
Download sequence
Identical sequences ENSGGOP00000008279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]