SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008281 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008281
Domain Number 1 Region: 22-137
Classification Level Classification E-value
Superfamily L domain-like 1.22e-21
Family U2A'-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008281   Gene: ENSGGOG00000008469   Transcript: ENSGGOT00000008510
Sequence length 753
Comment pep:known_by_projection chromosome:gorGor3.1:16:57562853:57620733:1 gene:ENSGGOG00000008469 transcript:ENSGGOT00000008510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQWELDEEGIRRLGTLTMEQPELVESLSLQGSYAGKIHSIGDAFRNFKNLRSLDLSRN
LITSLKGIQYLCSLQDLNLYYNNIPSLVEVSRLQPLPFLKELDLRLNPVVRKDTDYRLFA
VYTLQTLEKLDDRTVREGERKAAKLHFSQLGNSENFLLEVEKSSREKTMKNCVTGESSAS
KVSANVDSRIEMDSNKGLFIPFPNREIKDSLSTSATQGNGTPDQKLDTFPLGTQTQEVAR
REMPSDNHQEDEFRHYSPRHSTVRSPEKMTREGYQVSFLDNKSSGSSPEKELIPKPDTFH
LTHDASLSKRLDVGDSSQIHPYQLPSDVGLENYDSCYSQTLSLHGSLGKRPQRSKNYQEY
SIKPSNDIKATASHSCGDLLTSLSNPDSSTGRLLKLSSDLYATTHFNSDPAVLVNVEQQL
STSLGDLTPAHGSVPNNAVLGNRTTPLRTLLLSPGTSEHRKIFTKRSLSPSKRGFKWKDN
ILANLNLKHGFRDATGSEPLSSDLGSLHGLPGNHSPPISARTPHVATVLRQLLELVDKHW
NGSGSLLLNKKFLGPARDLLLSLVVPAPSQPRCCSHPEDTMKAFCRRELELKEAAQLVPN
DMESLKQKLVRVLEENLILSEKIQQLEEGAAISIVSGQQSHTYDDLLHKNQQLTMQVACL
NQELAQLKKLEETVAILHESQRSLVVTNEYLLQQLNKEPKGYSGKALLPPEKGHHLGRSS
PFGKSTLSSSPVAHDTGQYLIQSVLDAAPEPGL
Download sequence
Identical sequences G3QZH1
XP_004057857.1.27298 ENSGGOP00000008281 ENSGGOP00000008281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]