SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008297 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008297
Domain Number 1 Region: 2-116,166-269,676-918
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.23e-143
Family Calcium ATPase, transmembrane domain M 0.00000000000102
Further Details:      
 
Domain Number 2 Region: 282-525
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 9.15e-70
Family Metal cation-transporting ATPase, ATP-binding domain N 0.000000000923
Further Details:      
 
Domain Number 3 Region: 513-675
Classification Level Classification E-value
Superfamily HAD-like 1.03e-46
Family Meta-cation ATPase, catalytic domain P 0.000000153
Further Details:      
 
Domain Number 4 Region: 109-163
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000902
Family Calcium ATPase, transduction domain A 0.0000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008297   Gene: ENSGGOG00000008480   Transcript: ENSGGOT00000008526
Sequence length 927
Comment pep:known_by_projection chromosome:gorGor3.1:16:29730940:29756032:1 gene:ENSGGOG00000008480 transcript:ENSGGOT00000008526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGPNELPAEEGKTLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQESVSVIKHTEPV
PDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLD
EFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAV
ITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDG
DICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVY
EKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSM
SVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGSVKEKIMAVIKEWGT
GRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLC
RDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRAC
CFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMV
LADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLW
VNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAW
WFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALN
SLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKIS
LPVIGLDEILKFVARNYLEDAEDERRK
Download sequence
Identical sequences ENSGGOP00000008297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]