SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008309 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008309
Domain Number 1 Region: 932-1042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-37
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1390-1506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-36
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 2821-2945
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-35
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 4 Region: 589-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-34
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 5 Region: 2227-2334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-34
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 6 Region: 1169-1277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-34
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 7 Region: 1738-1848
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-33
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 8 Region: 1620-1733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 9 Region: 3068-3173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 10 Region: 1053-1158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-31
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 11 Region: 1509-1617
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-31
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 12 Region: 3177-3288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 13 Region: 1857-1964
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-30
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 14 Region: 1990-2089
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-29
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 15 Region: 1278-1387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-28
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 16 Region: 824-927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-27
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 17 Region: 2091-2212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-27
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 18 Region: 2335-2456
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-27
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 19 Region: 2462-2578
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-26
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 20 Region: 469-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-25
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 21 Region: 708-814
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 22 Region: 2655-2768
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-21
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 23 Region: 2952-3062
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-19
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 24 Region: 2577-2651
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-18
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 25 Region: 2771-2820
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000432
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 26 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000196
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 27 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000754
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 28 Region: 392-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000062
Family EGF-type module 0.023
Further Details:      
 
Domain Number 29 Region: 130-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 30 Region: 302-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000234
Family EGF-type module 0.016
Further Details:      
 
Domain Number 31 Region: 266-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000432
Family EGF-type module 0.019
Further Details:      
 
Domain Number 32 Region: 353-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000077
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008309   Gene: ENSGGOG00000008467   Transcript: ENSGGOT00000008538
Sequence length 3290
Comment pep:known_by_projection chromosome:gorGor3.1:10:17310927:17620607:-1 gene:ENSGGOG00000008467 transcript:ENSGGOT00000008538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMNMSLPFLWSLLTLLTFAEVNGEAGELELQRQKRSIHLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKDDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLIREQAGE
PKYSCICDAGWMSSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YVCEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLIDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDAVSGYFCKC
DSGWTGVNCTENINECLSSPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPDCGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPLLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGGELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFSINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRRMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATGSFSSPGYPNRYPPNKECIWYIRTAPGSSIQLTIHDFDVEY
HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN
ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ
DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC
GGHILTSSFDTVSSPRFPDNYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV
EILDGGHEDAPVRGRYCGTDMPHPITSFSSALTLRFVSDSSMSAGGFHTTVTASVSTCGG
TFYMAEGIFNSPGYPDVYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE
GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH
GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA
RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG
FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR
DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR
GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD
IYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN
VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDQFDIEVTPNCTSNYL
ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRV
TGQSGVVESIGHPTLPYRDNLFCEWHLHGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDN
HTSVFNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDA
VCGGSLPNIPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQENSSISIHFEDFYLESHQDC
QFDVLEFRVGDADGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTL
TFSDFDIEHHTTCAWDSITVKNGGSPESPIIGQYCGNSNLRTIESGSNELFLTFNSDHSL
QGGGFYATWNTQTLGCGGIFHSDNGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDN
NFLIPSGDGQCQNSFVKVWAGTEEVDKALLATGCGNVAPGPVITPSNTFTAVFQSQEAPA
QGFSASFVSRCGRNFTGPSGYIVSPNYPKQYDNNMNYTYVIEANPLVVLLTFVSFHLEGP
QQGCGGYLTGSNNTFASPDSDSNGMYDKNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQ
RCLYDYVKLYDGDSENANLAGTFCGSTVPAPFMSSGNFLTVQFISDLTLEREGFNATYTI
MDMPCSGTYNATWTPQNISSPNSSDPDVPFSICTWVIDSPPHQQVKITVWALQLTSQDCT
QNYLQLQDSPQGHGNSRIQFCGRNASAVPVFYSSMSTAIVIFKSGVVNRNSRMSFTYQIA
DCNRDYHKAFGNLRSPGWPRNYDNDKDCTVTLTAPQNHTISLFFHSFGIENSVECRNDFL
EVRNGSNSNSPLLGKYCGTLLPNPVFSQNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGG
TLYGDRGSFTSPGYPGTYPNNTHCEWVLVAPAGRLVTINFYFISIDDPGDCVQNYLTLYD
GPNASSPSSGPYCGGDTSIAPFVASSNQVFIKFHADYARRPSAFRLTWDS
Download sequence
Identical sequences ENSGGOP00000008309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]