SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008334 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008334
Domain Number 1 Region: 23-267,337-389
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.7e-110
Family Type II chitinase 0.0000000061
Further Details:      
 
Domain Number 2 Region: 267-336
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.2e-25
Family Chitinase insertion domain 0.0000305
Further Details:      
 
Domain Number 3 Region: 429-475
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000112
Family Tachycitin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008334   Gene: ENSGGOG00000008523   Transcript: ENSGGOT00000008564
Sequence length 476
Comment pep:known_by_projection chromosome:gorGor3.1:1:114280289:114290494:1 gene:ENSGGOG00000008523 transcript:ENSGGOT00000008564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLILLTGLVLVLNLQLGSAYQLTCYFTNWAQYRPGLGRFMPDDIDPCLCTHLIYAFAG
MQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFI
TSVIKFLRQYEFDGLDFDWEYPGSHGSPPQDKHLFTVLVQEMREAFEQEATQINKPRLMV
TAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAY
LNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSSTGIGAPTSGAGPAGPYTKESGI
WAYYEICTFLKNGATQEWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVW
AIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITADPSGSGNGSGSSSS
GGSSGGSGFCAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Download sequence
Identical sequences G3QZM1
ENSGGOP00000008334 ENSGGOP00000008334 XP_004026380.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]