SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008381 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008381
Domain Number 1 Region: 25-115
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000631
Family FHA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008381   Gene: ENSGGOG00000008577   Transcript: ENSGGOT00000008612
Sequence length 161
Comment pep:known_by_projection chromosome:gorGor3.1:5:118903975:118907505:-1 gene:ENSGGOG00000008577 transcript:ENSGGOT00000008612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGKDAHLQLQLPRLSRRHLSL
EPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGT
SLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQEQPPPGSG
Download sequence
Identical sequences A0A2I2ZAU2
ENSGGOP00000008381 XP_004042586.1.27298 ENSGGOP00000008381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]