SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008385 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008385
Domain Number 1 Region: 48-409
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.72e-66
Family Ankyrin repeat 0.0000196
Further Details:      
 
Domain Number 2 Region: 524-579
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000131
Family SOCS box-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008385   Gene: ENSGGOG00000008574   Transcript: ENSGGOT00000008616
Sequence length 588
Comment pep:known_by_projection chromosome:gorGor3.1:7:121657463:121686337:1 gene:ENSGGOG00000008574 transcript:ENSGGOT00000008616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFVPLSAQNRKLVEAIKQGHILELQ
EYVKYKYAMDEADEKGWFPLHEAVVQPIQQILEIVLDASYKTLWEFKTSDGETPLTLAVK
AGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSA
MHEAAKQGRKDTVALLLKHGGNVHLRDGFGVTPLGVAAEYGHCDVLEHLIHKGGDVLALA
DDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKYLIPVTS
KNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLLADHISQSYDDERKTALYFAVSN
NDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRLLLSHGANVNCYFMHVNDTRFPS
VIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNP
FCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSALEVQREWPEIRQILENPCSLKHL
CRLKIRRLMGLQKLCQPASVEKLPLPPAIQRYILFKEYDLYGQELKLT
Download sequence
Identical sequences ENSGGOP00000008385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]