SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000008427

Domain assignment for ENSGGOP00000008427 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000008427
Domain Number 1	Region: 123-215
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	3.34e-20
Family	I set domains	0.033
Further Details:

Domain Number 2	Region: 44-123
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.0000182
Family	I set domains	0.032
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000008427 Gene: ENSGGOG00000008620 Transcript: ENSGGOT00000008659
Sequence length	262
Comment	pep:known_by_projection chromosome:gorGor3.1:5:53985334:54003121:1 gene:ENSGGOG00000008620 transcript:ENSGGOT00000008659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAWKSSVIMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLICAVQNHT REEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSISVVLNVT FPPLLSGNDFQTVEEGSNVKLVCSVKANPQAQMMWYKNSSLLDLEKSHHQIQQTSESFQL SIIKVEKSDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVPIEPIIAACVVIFLTLCFGLI ARRKKIMKLCMKDKDPHSETAL
Download sequence
Identical sequences	G3QZV8 ENSGGOP00000008427 ENSGGOP00000008427 XP_004042040.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]