SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008436 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008436
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-21
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.56e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008436   Gene: ENSGGOG00000008632   Transcript: ENSGGOT00000008668
Sequence length 345
Comment pep:known_by_projection chromosome:gorGor3.1:4:167117923:167343579:-1 gene:ENSGGOG00000008632 transcript:ENSGGOT00000008668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Download sequence
Identical sequences G3QZW6 Q9NRA1
ENSP00000274071 NP_057289.1.87134 NP_057289.1.92137 XP_004040602.1.27298 9606.ENSP00000274071 gi|9994187|ref|NP_057289.1| ENSP00000422464 ENSGGOP00000008436 ENSP00000422464 ENSGGOP00000008436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]