SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008482 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008482
Domain Number 1 Region: 7-101
Classification Level Classification E-value
Superfamily EF-hand 1.54e-28
Family S100 proteins 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008482   Gene: ENSGGOG00000008680   Transcript: ENSGGOT00000008715
Sequence length 105
Comment pep:known_by_projection chromosome:gorGor3.1:1:130987606:130992148:-1 gene:ENSGGOG00000008680 transcript:ENSGGOT00000008715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Download sequence
Identical sequences A0A2K5PJE5 G1RH69 G3R007 H2N5T5 H2Q002 P31949 V9HWH9
ENSGGOP00000008482 001007202|e2lucA1|108.1.1.8|A:1-105 001016350|e2lucB1|108.1.1.8|B:1-105 d2luca_ d2lucb_ ENSNLEP00000012569 gi|5032057|ref|NP_005611.1| NP_005611.1.87134 NP_005611.1.92137 XP_002810252.1.23681 XP_003259306.1.23891 XP_003339045.1.37143 XP_003817270.1.60992 XP_004026717.1.27298 XP_017353626.1.71028 XP_017375585.1.71028 ENSPTRP00000002223 ENSP00000271638 2luc_A 2luc_B ENSNLEP00000012569 ENSP00000271638 ENSP00000271638 ENSPPYP00000000990 ENSPTRP00000002223 ENSPPYP00000000990 9598.ENSPTRP00000002223 9600.ENSPPYP00000000990 9606.ENSP00000271638 ENSGGOP00000008482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]