SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008485 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008485
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000979
Family S100 proteins 0.0000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008485   Gene: ENSGGOG00000008684   Transcript: ENSGGOT00000008718
Sequence length 97
Comment pep:novel chromosome:gorGor3.1:5:33210255:33210545:1 gene:ENSGGOG00000008684 transcript:ENSGGOT00000008718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPSPMEHTMETVLFTFHRFAGDKGYLMKQGLKVFMGKEFPGFLENQKDPLAADITMKDMD
QCQDSTLNFQNLFSLTAGLTTVDNNYFVVPMRQKGTK
Download sequence
Identical sequences ENSGGOP00000008485 ENSGGOP00000008485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]