SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008500 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008500
Domain Number 1 Region: 284-411
Classification Level Classification E-value
Superfamily Second domain of FERM 1.32e-31
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 413-517
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-24
Family Third domain of FERM 0.0057
Further Details:      
 
Domain Number 3 Region: 37-148
Classification Level Classification E-value
Superfamily PDZ domain-like 3.96e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 195-278
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000062
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008500   Gene: ENSGGOG00000008693   Transcript: ENSGGOT00000008733
Sequence length 1757
Comment pep:known_by_projection chromosome:gorGor3.1:X:12387168:12619109:1 gene:ENSGGOG00000008693 transcript:ENSGGOT00000008733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFFSSHRTKSSGWPPPSGTWGLSQVPPYGWEMTANRDGRDYFINHMTQAIPFDDPRLES
CQIIPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMINDEPV
SAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEVIING
QVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLM
LEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYL
YVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPS
AVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATL
VQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLVRVELHVLD
VKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGPENKGKHNLLG
PDWNCIPQMTTFIGEGEQEAQITYIDSKQKTVEITDSTMCPKEHRHLYIDNAYSSDGLNQ
QLSQPGEAPCEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVSFIFGDFTLDDGISPPT
LGYETLLDEGPEMLEKQRNLYIGSANDMKGLDLTPEAEGIQFVENSVYANIGDVKSFQAA
EGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDIIDLTSLPP
PEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFPEDKEKGSSLQNDEIPVS
LIDAVPTSAEGKCEKGLDNAVVSTLGALEALSVSEEQQTSDNSGVAILRAYSPESSSDSG
NETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPAGGLPPKSS
HTLAARPATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRK
SKLADGEGKAPPNGNTTGKKQQGTKTAEMEEEASGKFGTVSSRDSQHLSTFNLERTAFRK
DSQRWYVATEGGMAEKSGLEAATGKTFPRASGLGAREAEGKEEGAPDGETSDGSGLGQGD
RFLTDVTCASSAKDLDNPEDADSSTCDHPSKLPEADESVARLCDYHLAKRMSSLQSEGHF
SLQSSQGSSVDAGCGTGSSGSACATPVESPLCPSLGKHLIPDASGKGVNYIPSEERAPGL
PNHGATFKELHPQTEGMCPRMTVPALHTAINTEPLFGTLRDGCHRLPKIKETTASVALTE
PGKERRGGMPSAWSQHPEADPILLPSNIHSESKVPIPNQDPNDFSQANQAYGEAVSWRPP
DLRGGSLRTPPSQKALRHSSSILSGSVDLETFRERTKGAVSLKCPGITEAQEASSERRAE
LPLGRKLTKSFSQSSMHLSSEGRFHKRSPVAHKDSKLYRTLPLRKLEGSNWRCRGPFSYC
FLNRGQDEDGEEEEERGEATVQVSCLYRPQMTQAMPEPSSPCLAVAIQKQRGELSRGSVL
KVWAEDLRDPDDLDFSNLAFDARIARINALKESTYAMPDGFLAAQNDANELLCLVRATKE
KREESRPEAYDLTLSQYKQLLSIESRQLGSACRKMAMAEKSPEEMLLAMTSSFQVLCCLT
EACMRLVKVVNSETQRQEIVGKIDEVVINYICLLKAAEAATGKNPGDPNVGLSARHSTTM
AALVSTLTRSLKRLLNK
Download sequence
Identical sequences ENSGGOP00000008500 ENSGGOP00000008500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]