SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008509 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008509
Domain Number 1 Region: 270-318,380-677
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.71e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000221
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-27
Family Zf-UBP 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008509   Gene: ENSGGOG00000008702   Transcript: ENSGGOT00000008742
Sequence length 712
Comment pep:known_by_projection chromosome:gorGor3.1:12:94634207:94668751:-1 gene:ENSGGOG00000008702 transcript:ENSGGOT00000008742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAMDKCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYHCTTRSGRFL
RSVGTGDDSYFLHDGAQSLLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPF
QEKIVVKREVKKRQQELEYQVKAELESMLPRKSLRLQGLAQSTIIEIVSVQVPAQTPASP
AKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVRSRQSSLSSGLSGGA
SKSRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCL
ACDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQC
NSKRRRFSAKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM
EPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMC
TMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPSEDADTSSNEILS
Download sequence
Identical sequences G3R033
ENSGGOP00000008509 XP_004053744.1.27298 XP_004053745.1.27298 XP_018894514.1.27298 XP_018894515.1.27298 XP_018894516.1.27298 XP_018894517.1.27298 XP_018894518.1.27298 ENSGGOP00000008509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]