SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008553 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008553
Domain Number 1 Region: 832-1119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-78
Family Protein kinases, catalytic subunit 0.000000000339
Further Details:      
 
Domain Number 2 Region: 558-737
Classification Level Classification E-value
Superfamily Fibronectin type III 1.64e-27
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 445-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000101
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 4 Region: 353-451
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000459
Family I set domains 0.029
Further Details:      
 
Domain Number 5 Region: 134-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000695
Family I set domains 0.079
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008553
Domain Number - Region: 316-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 226-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0737
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008553   Gene: ENSGGOG00000008745   Transcript: ENSGGOT00000008788
Sequence length 1138
Comment pep:known_by_projection chromosome:gorGor3.1:1:44794779:44816146:1 gene:ENSGGOG00000008745 transcript:ENSGGOT00000008788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCMGGAGARRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTV
RLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGPDRLRVSWSLPLVPGPLVGDGFLLRLWDGARGQERRENVSSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWQHPEALPGPISKYIVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRVRA
SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Download sequence
Identical sequences ENSGGOP00000008553 ENSGGOP00000008553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]