SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008578 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008578
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.08e-45
Family MHC antigen-recognition domain 0.00000000683
Further Details:      
 
Domain Number 2 Region: 181-271
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000152
Family C1 set domains (antibody constant domain-like) 0.0000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008578   Gene: ENSGGOG00000008774   Transcript: ENSGGOT00000008813
Sequence length 345
Comment pep:known_by_projection chromosome:gorGor3.1:19:46752809:46864569:1 gene:ENSGGOG00000008774 transcript:ENSGGOT00000008813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQV
SWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWK
EPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHAS
SSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALL
WRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADSKDVNVIPATA
Download sequence
Identical sequences ENSGGOP00000008578 ENSGGOP00000008578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]