SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008581 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008581
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000122
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008581   Gene: ENSGGOG00000008780   Transcript: ENSGGOT00000008816
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:21:21385286:21386203:1 gene:ENSGGOG00000008780 transcript:ENSGGOT00000008816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPVSSASLPGSGLPSVGSIRPP
HGLLKSPSSGASGGFQHWGGMPCPCSMCQVPPPHHH
Download sequence
Identical sequences ENSGGOP00000008581 ENSGGOP00000008581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]