SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008587 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008587
Domain Number 1 Region: 166-321
Classification Level Classification E-value
Superfamily EF-hand 4.3e-26
Family Calmodulin-like 0.037
Further Details:      
 
Domain Number 2 Region: 52-156
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000294
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008587   Gene: ENSGGOG00000008781   Transcript: ENSGGOT00000008822
Sequence length 328
Comment pep:known_by_projection chromosome:gorGor3.1:19:46865778:46882660:1 gene:ENSGGOG00000008781 transcript:ENSGGOT00000008822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWRPSLLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFL
GREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSA
AWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGD
SMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPA
WVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKA
EILGNWNMFVGSQATNYGEDLTRHHDEL
Download sequence
Identical sequences A0A2I2YEW1
XP_004061216.1.27298 XP_018870111.1.27298 XP_018870112.1.27298 XP_018870113.1.27298 ENSGGOP00000008587 ENSGGOP00000008587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]