SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000008587

Domain assignment for ENSGGOP00000008587 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000008587
Domain Number 1	Region: 166-321
Classification Level	Classification	E-value
Superfamily	EF-hand	4.3e-26
Family	Calmodulin-like	0.037
Further Details:

Domain Number 2	Region: 52-156
Classification Level	Classification	E-value
Superfamily	EF-hand	0.000000000000294
Family	Calmodulin-like	0.051
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000008587 Gene: ENSGGOG00000008781 Transcript: ENSGGOT00000008822
Sequence length	328
Comment	pep:known_by_projection chromosome:gorGor3.1:19:46865778:46882660:1 gene:ENSGGOG00000008781 transcript:ENSGGOT00000008822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MMWRPSLLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFL GREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSA AWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGD SMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPA WVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKA EILGNWNMFVGSQATNYGEDLTRHHDEL
Download sequence
Identical sequences	A0A2I2YEW1 ENSGGOP00000008587 ENSGGOP00000008587 XP_004061216.1.27298 XP_018870111.1.27298 XP_018870112.1.27298 XP_018870113.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]