SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008590
Domain Number 1 Region: 131-454
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.69e-66
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000179
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.97e-30
Family Ricin B-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008590   Gene: ENSGGOG00000008784   Transcript: ENSGGOT00000008825
Sequence length 608
Comment pep:known_by_projection chromosome:gorGor3.1:7:150575082:150618843:1 gene:ENSGGOG00000008784 transcript:ENSGGOT00000008825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPIKGSGPHGPSPKKFYPRFT
RGPSRVLEPQFKANKIDDVIDSRVEDPEEGHLKFSSELGMIFNERDQELRDLGYQKHAFN
MLISNRLGYHRDVPDTRNAACKEKFYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPA
HLLHEIILVDDDSDFDDLKGELDEYVQKYLPGKIKVIRNTKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGGAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD
LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVL
QRGRLYHLQTNRCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRAVDPLGQKGSVAMAICDGSS
SQQWHLEG
Download sequence
Identical sequences G3R0A7
ENSGGOP00000008590 XP_004046573.1.27298 XP_018887252.1.27298 XP_018887253.1.27298 ENSGGOP00000008590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]