SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008600 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008600
Domain Number 1 Region: 406-581
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.31e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000139
Further Details:      
 
Domain Number 2 Region: 583-683
Classification Level Classification E-value
Superfamily E set domains 1.1e-25
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008600
Domain Number - Region: 85-111
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0654
Family Obg GTP-binding protein N-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008600   Gene: ENSGGOG00000008797   Transcript: ENSGGOT00000008835
Sequence length 898
Comment pep:known_by_projection chromosome:gorGor3.1:14:5318936:5328819:1 gene:ENSGGOG00000008797 transcript:ENSGGOT00000008835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITTLPSLLPASLASISHRVTNLPSNSLSHNPLDSEDAPPCCRLALGEPPPYGAAPIGIP
RPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITSIS
PTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFF
SDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGGRG
PEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPPPP
LPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEESV
APPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIE
VQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHAFY
QVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETD
IGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRGGE
ELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPV
QVYFYVSNGRRKRSPTQSFKFLPVICKEEPLPDSSLRGFPSASAPPLGTDMDFSPPRPPY
PSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPPVSF
LPRPFPSDPYGGRGSSFPLGLPFSPPAPFRPPLPASPPLEGPFPSQSDVHPLPAEGYNKV
GPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEGGCGTGGCECECVQEIALHVC
Download sequence
Identical sequences ENSGGOP00000008600 ENSGGOP00000008600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]