SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008644 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008644
Domain Number 1 Region: 109-268
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-35
Family C-type lectin domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008644   Gene: ENSGGOG00000008840   Transcript: ENSGGOT00000008880
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:12:10047991:10056143:1 gene:ENSGGOG00000008840 transcript:ENSGGOT00000008880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLLTLCLMLLIGLVTL
GMMFLQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQ
EQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLV
KTDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLFSTKELDQINGSK
GCAYFQKGNIYISHCSTEIFWICEKTAAPVKIEDLD
Download sequence
Identical sequences G3R0F9
ENSGGOP00000008644 XP_004052738.1.27298 ENSGGOP00000008644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]