SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008648 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008648
Domain Number 1 Region: 47-262
Classification Level Classification E-value
Superfamily t-snare proteins 1.33e-44
Family t-snare proteins 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008648   Gene: ENSGGOG00000008847   Transcript: ENSGGOT00000008884
Sequence length 294
Comment pep:known_by_projection chromosome:gorGor3.1:3:92961935:92976227:-1 gene:ENSGGOG00000008847 transcript:ENSGGOT00000008884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDRLQELKQRTKEIELSRDSHVSTTETEEQGVFLQQAVIYEREPVAERHLHEIQKLQES
INNLADNVQKFGQQQKSLVASMRRFSLLKRESTITKEIKIQAEYINRSLNDLVKEVKKSE
VENGPSSVVTRILKSQHAAMFRHFQQIMFIYNDTIAAKQEKCKTFILRQLEVAGKEMSEE
DVNDMLHQGKWEVFNESLLTEINITKAQLSEIEQRHKELVNLENQIKDLRDLFIQISLLV
EEQGESINNIEMTVNSTKEYVNNTKEKFGLAVKYKKRNPCRVLCCWCCPCCSSK
Download sequence
Identical sequences G3R0G3 Q8N4C7
ENSGGOP00000008648 gi|49258196|ref|NP_001001850.1| 9606.ENSP00000320679 ENSP00000320679 ENSP00000320679 ENSGGOP00000008648 ENSP00000320679 NP_001001850.1.87134 NP_001001850.1.92137 XP_004035984.1.27298 XP_011511144.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]