SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008650 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008650
Domain Number 1 Region: 263-390,502-747
Classification Level Classification E-value
Superfamily L domain-like 5.87e-45
Family Leucine rich effector protein YopM 0.0075
Further Details:      
 
Domain Number 2 Region: 779-1034
Classification Level Classification E-value
Superfamily PP2C-like 7.85e-40
Family PP2C-like 0.003
Further Details:      
 
Domain Number 3 Region: 393-559
Classification Level Classification E-value
Superfamily L domain-like 1.65e-17
Family Ngr ectodomain-like 0.063
Further Details:      
 
Domain Number 4 Region: 144-242
Classification Level Classification E-value
Superfamily PH domain-like 0.00000228
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008650   Gene: ENSGGOG00000008841   Transcript: ENSGGOT00000008886
Sequence length 1323
Comment pep:known_by_projection chromosome:gorGor3.1:16:61828013:61972514:-1 gene:ENSGGOG00000008841 transcript:ENSGGOT00000008886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSS
DLHLVLCTVETPASEICAGERRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPV
RIQEEATNPDLGCMIRFYGEKPCHMDHLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTC
LIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQ
RQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQ
LKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTL
PEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV
DLRMNHLKTMVIENLEGNKHVTHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGF
SLRTLYASSNRLTSVNVYPVPSLLTSLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEV
PVRILSSLSLRKLMLGHNHVQNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLN
ASANSLESLPSACTEEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFP
ASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDL
SCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVT
STFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGT
CQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP
WILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSY
GCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEF
SSEISTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSLHPTPTFGLFQRQPSCATFSS
NQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLVESSPTPCSEEHARG
SCFGIRRQNSVNSGILLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE
VPKRKTGYFAAPTQMEPEDQFVVPRDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFD
TAL
Download sequence
Identical sequences A0A2I2ZVR0
XP_004057998.1.27298 ENSGGOP00000008650 ENSGGOP00000008650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]