SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008657 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008657
Domain Number 1 Region: 65-368,535-570
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.12e-47
Family FAD-linked reductases, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008657   Gene: ENSGGOG00000008852   Transcript: ENSGGOT00000008893
Sequence length 610
Comment pep:known_by_projection chromosome:gorGor3.1:2a:86859065:86871804:-1 gene:ENSGGOG00000008852 transcript:ENSGGOT00000008893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLPLVLLLAVLLLAVLCKVYLGLFSGSSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFS
ANRVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGI
HYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPMYSGEKAYIQGL
KEKFPQEEAIIDKYIKLVKVVSSGAPHAILLKFLPLPVVQLLDRCGLLTRFSPFLQASTQ
SLAEVLQQLGASSELQAVLSYIFPTYGVTPSHSAFSMHALLVNHYMKGGFYPRGGSSEIA
FHTIPVIQRAGGAVLTKATVQSVLLDSAGKACGVSVKKGHELVNIHCPIVVSNAGLFNTY
EHLLPGNARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLHLPSTNYYVYYDTDMDQAM
ERYVSMPREEAAEHIPLLFFAFPSAKDPTWEDRFPGRSTMIILIPTAYEWFEEWQAELKG
KRGSDYETFKNSFVEASMSVVLKLFPQLEGKVESVTAGSPLTNQFYLASPRGACYGADHD
LGRLHPCVMASLRAQSPIPNLYLTGQDIFTCGLVGALQGALLCSSAILKRNLYSDLKNLD
SRIRAQKKKN
Download sequence
Identical sequences G3R0H2
XP_004029584.1.27298 ENSGGOP00000008657 ENSGGOP00000008657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]