SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008711 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008711
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 1.55e-17
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008711
Domain Number - Region: 136-292
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00445
Family Apolipoprotein A-I 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008711   Gene: ENSGGOG00000008912   Transcript: ENSGGOT00000008948
Sequence length 295
Comment pep:novel chromosome:gorGor3.1:11:49690832:49694514:-1 gene:ENSGGOG00000008912 transcript:ENSGGOT00000008948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQRELICPICVNYFIDPVTIDCGHSFCRPCFYLNWQDMAVLAQCSKCKKTTR
QSNLKTNICLKNMASIARKASLRQFLSSEEQICGTHREKKKMFCEVDKSLLCLLCSNSQE
HRNHRDCPTEWAAEEHREELLRKMQSLWRKMCENHRNLNMATNRIRCWKDYVSLRIEAIR
AEYHKMVAFFHEEEQRHLERLQKEGEDIFQQLNESKARMEHSRELLRGMYEDLRQMCHKA
VVELFQGWEGTASPSDSTRPKVPPTLSTSNKTMWNGQGFLKSLLETYYKDIDTTL
Download sequence
Identical sequences ENSGGOP00000008711 ENSGGOP00000008711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]