SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008729 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008729
Domain Number 1 Region: 244-321
Classification Level Classification E-value
Superfamily HMG-box 1.2e-16
Family HMG-box 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008729   Gene: ENSGGOG00000008921   Transcript: ENSGGOT00000008967
Sequence length 1513
Comment pep:known_by_projection chromosome:gorGor3.1:5:133849979:133903339:1 gene:ENSGGOG00000008921 transcript:ENSGGOT00000008967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRTQPRPCYLNAPQQCPRAERPGRPTAGSHSFLLRPGPLAGSSPFALLDPLQAFEQFVW
VRPQARAGLLRLRQGSHAVTRRRPLPVRREGRRDGSPWRSVVCRCCRCSRQTGASVTTVS
LLSSSSSPGLDPRGPRQASVREGLSRLRAVCRRAGPRGRGSFSPRDARASPRLHFLVAAV
TTGAASRRQRGARVRQPSPSSSRRAKRLRECERRSLHAPPAMDASYDGTEVTVVMEEIEE
AYCYTSPGPPKKKKKYKIHGEKAKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISES
WRLLSVAERSYYLEKAKLEKEGLDPNSKLSALTAVVPDIPGFRKILPRSDYIIIPKSSLQ
EDRSCPQLELCVAQNQMSPKEPPLVSNTAPETVPSHAGMAEQCLAVEALAEEVGALTQSG
AVQEIATSEILSQDVLLEDASLEVGESHQPYQTSLVIEETLVNGSPDLPTGSLAVPHHQV
GESVSVVTVMRDSSESSSSAPATQFIMLPLPAYSVVENPTSIKLTTTYTRRGHGTCTSPG
CSFTYVTRHKPPKCPTCGNFLGGKWIPKEKPAKVKVELASGVSSKGSVVKRNQQPVTTEQ
NSSKENASKLTLENSEAVSQLLNVAPPRELGEESEWEEVIISDAHVLVKEAPGNCGTAVT
KTPVVKSGVQPEVTLGTTDNDSPGADVPTPSEGTSTSSPLPAPKKPTGVDLLTPGSRPPE
LKGRARGKPSLLAAARPMRAILPAPVNVGRGSSMGLPRARQAFSLSDKTPSVRTCGLKPS
TLKQLGQPIQQPSGPGEVKLPSGPSNRTSQVKVVEVKPDMFPPYKYSCTVTLDLGLATSR
GRGKCKNPSCSYVYTNRHKPRICPSCGVNLAKDRTEKTTKAIEVSSPLPDVLNATEPLST
AQREIQRQSTLQLLRKVLQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWS
NYYESPSTQCLLCSSPLFKGGQNSLAGPQECWLLTASRLQTVTAQVKMCLNPHCLALHSF
IDIYTGLFNVGNKLLVSLDLLFAIRNQIKLGEDPRVSINVVLKSVQEQTEKTLTSEELSQ
LQELLCNGYWAFECLTVRDYNDMICGICGVAPKVEMAQRSEENVLALKSVEFTWPEFLGS
NEVNVEDFWATMETEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKNLDV
QPVPGSGSALVRLLQEGTCKLDEIGSYSEEKLQHLLRQCGIPFGAEDSKDQLCFSLLALY
ESVQNGARAIRPPRHFTGGKIYKVCPHQVVCGSKYLVRGESARDHVDLLASSRHWPPVYV
VDMATSVALCADLCYPELTNQMWGRNQGCFSSPTEPPVCVSCPELLDQHYTVDMTETEHS
IQHPVTKTAMRRIVHAGIQPNPGDPSAGHHSLALCPELAPYATILASIVDSKPNSVRQRP
IAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQSCQPGEVVIRDTLYRLGVAQIKTETE
EEGEEEEVATVAE
Download sequence
Identical sequences ENSGGOP00000008729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]