SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008755 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008755
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-31
Family C-type lectin domain 0.000000921
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000000000222
Family Triple coiled coil domain of C-type lectins 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008755   Gene: ENSGGOG00000008952   Transcript: ENSGGOT00000008994
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:10:92891078:92902565:-1 gene:ENSGGOG00000008952 transcript:ENSGGOT00000008994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTTPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNA
GAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAAL
QQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDKACGEKRLVVCEF
Download sequence
Identical sequences G3R0R1
XP_018890463.1.27298 ENSGGOP00000008755 ENSGGOP00000008755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]