SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008765 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008765
Domain Number 1 Region: 62-410
Classification Level Classification E-value
Superfamily Sialidases 1.46e-83
Family Sialidases (neuraminidases) 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008765   Gene: ENSGGOG00000008963   Transcript: ENSGGOT00000009004
Sequence length 415
Comment pep:known_by_projection chromosome:gorGor3.1:6:32757184:32761067:-1 gene:ENSGGOG00000008963 transcript:ENSGGOT00000009004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Download sequence
Identical sequences G3R0S0 H2QSP6 Q5JQI0 Q5RAF4 Q99519
NP_000425.1.87134 NP_000425.1.92137 NP_001125743.1.23681 XP_001160380.1.37143 XP_004043753.1.27298 gi|4557791|ref|NP_000425.1| ENSGGOP00000008765 ENSP00000229725 ENSP00000364782 ENSP00000399309 ENSP00000401067 ENSP00000403720 ENSP00000408207 ENSP00000408957 ENSP00000409489 ENSPTRP00000030706 ENSP00000229725 ENSP00000364782 ENSP00000399309 ENSP00000401067 ENSP00000403720 ENSP00000408207 ENSP00000408957 ENSP00000409489 ENSP00000229725 ENSP00000364782 ENSP00000399309 ENSP00000401067 ENSP00000403720 ENSP00000408207 ENSP00000408957 ENSP00000409489 ENSPTRP00000030706 9598.ENSPTRP00000030706 9606.ENSP00000229725 9606.ENSP00000364782 9606.ENSP00000399309 9606.ENSP00000401067 9606.ENSP00000403720 9606.ENSP00000408207 9606.ENSP00000408957 9606.ENSP00000409489 ENSGGOP00000008765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]