SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008791 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008791
Domain Number 1 Region: 59-94,220-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-60
Family Nuclear receptor ligand-binding domain 0.000000243
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.09e-24
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008791   Gene: ENSGGOG00000008994   Transcript: ENSGGOT00000009030
Sequence length 461
Comment pep:known_by_projection chromosome:gorGor3.1:9:107872456:107898569:-1 gene:ENSGGOG00000008994 transcript:ENSGGOT00000009030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYMLPPSLHAPEPKGLATGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPQQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences G3R0U5
ENSGGOP00000008791 ENSGGOP00000008791 XP_004048641.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]