SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008800 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000008800
Domain Number - Region: 208-217,298-335
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008800   Gene: ENSGGOG00000009002   Transcript: ENSGGOT00000009040
Sequence length 386
Comment pep:known_by_projection chromosome:gorGor3.1:6:136945544:136964875:-1 gene:ENSGGOG00000009002 transcript:ENSGGOT00000009040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLILNILREMLEYFGVPVEQVLLIWENKDYGSTRSIVRIIGKMLPLEPCRRPNFELIPL
LNSVDSDNCGSMVPSFADILYVANDEEASYLRFRNSIWKNEEEKVEIFHPLRLVRDPLSP
AVRQKETVKNDLPVNEAAIRKIAALENELTFLRSQIAAIVEMQELKNSTNSSSFGLSDER
ISLGQLSSSRAARPSVDPDQLPGSVLSPPPPPPPLPPQSSSLQPPCFPPIQPGSNNICDS
DNPATEMSKQNPAANKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHK
RKRQNSHWDPVSLISHALKQKFAFQEDDSFEKENRSWESSPFSSPETSRFGHHISQSEGQ
RTEEEMVNTKAVDQGISNTSLLNSRI
Download sequence
Identical sequences G3R0V4
ENSGGOP00000008800 XP_004044778.1.27298 XP_018885100.1.27298 ENSGGOP00000008800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]