SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008803 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008803
Domain Number 1 Region: 247-288
Classification Level Classification E-value
Superfamily CCCH zinc finger 8.24e-17
Family CCCH zinc finger 0.001
Further Details:      
 
Domain Number 2 Region: 219-245
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000102
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 192-216
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000759
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008803   Gene: ENSGGOG00000009004   Transcript: ENSGGOT00000009044
Sequence length 291
Comment pep:known_by_projection chromosome:gorGor3.1:2a:110024585:110064559:-1 gene:ENSGGOG00000009004 transcript:ENSGGOT00000009044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFENLFSKPPNPALGKTATDSDERIDDEIDTEVEETQEEKIKLECEQIPKKFRHSAISP
KSSLHRKSRSKDYDVYSDNDICSQESEDNFAKELQQYIQAREMANAAQPEESTKKEGVKD
TPQAAKQKNKNLKAGRKNGKQKKMKRKWPGPGNKGSNALLRDSGSQDEDGKPKEKQQHLS
QAFINQHTVERKGKQICKYFLERKCIKGDQCKFDHDAEIEKKKEMCKFYVQGYCTRGENC
LYLHNEYPCKFYHTGTKCYQGEYCKFSHAPLTPETQELLAKVLDTEKKSCK
Download sequence
Identical sequences G3R0V7
ENSGGOP00000008803 XP_004031657.1.27298 ENSGGOP00000008803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]