SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008831 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008831
Domain Number 1 Region: 339-600
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-80
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-47
Family Pleckstrin-homology domain (PH domain) 0.0000302
Further Details:      
 
Domain Number 3 Region: 223-370
Classification Level Classification E-value
Superfamily SH2 domain 3.04e-29
Family SH2 domain 0.0000235
Further Details:      
 
Domain Number 4 Region: 163-232
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000614
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008831   Gene: ENSGGOG00000009028   Transcript: ENSGGOT00000009071
Sequence length 612
Comment pep:known_by_projection chromosome:gorGor3.1:4:48594530:48695464:-1 gene:ENSGGOG00000009028 transcript:ENSGGOT00000009071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGHENEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQ
LLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHA
FGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSG
LFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIY
IVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSE
AGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVF
TEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTI
DELVECEETFGR
Download sequence
Identical sequences ENSGGOP00000008831 ENSGGOP00000008831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]